General Information

  • ID:  hor002234
  • Uniprot ID:  P01347
  • Protein name:  Relaxin A chain
  • Gene name:  Rln1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007283 spermatogenesis; GO:0010749 regulation of nitric oxide mediated signal transduction; GO:0042127 regulation of cell population proliferation; GO:0042981 regulation of apoptotic process; GO:0043066 negative regulation of apoptotic process; GO:0048589 developmental growth; GO:0050878 regulation of body fluid levels; GO:0060443 mammary gland morphogenesis; GO:0060618 nipple development; GO:0060736 prostate gland growth
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QSGALLSEQCCHIGCTRRSIAKLC
  • Length:  24
  • Propeptide:  MSSRLLLQLLGFWLFLSQPCRARVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLALSQEEPAPLARQATAEVVPSFINKDAEPFDMTLKCLPNLSEERKAALSEGRAPFPELQQHAPALSDSVVSLEGFKKTFHNQLGEAEDGGPPELKYLGSDAQSRKKRQSGALLSEQCCHIGCTRRSIAKLC
  • Signal peptide:  MSSRLLLQLLGFWLFLSQPCRA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Rxfp2, Rxfp1
  • Target Unid:  Q5ECL0, Q6R6I6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-15
  • Structure ID:  AF-P01347-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002234_AF2.pdbhor002234_ESM.pdb

Physical Information

Mass: 298849 Formula: C104H181N35O33S4
Absent amino acids: DFMNPVWY Common amino acids: C
pI: 8.35 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 7
Hydrophobicity: 14.58 Boman Index: -3549
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 89.58
Instability Index: 12137.5 Extinction Coefficient cystines: 250
Absorbance 280nm: 10.87

Literature

  • PubMed ID:  7004862
  • Title:  Limited Sequence Homology Between Porcine and Rat Relaxins: Implications for Physiological Studies